Recombinant Human DICER1, GST-tagged

• Cat.No.: DICER1-4738H
• Product Overview: Recombinant Human DICER1(1813 a.a. - 1912 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1813-1912 a.a.
• Description: This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the sameprotein have been identified for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: Theoretical MW (kDa):36.74
• AA Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGK GKFKGVGRSYRIAKSAAARRALRSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: DICER1 dicer 1, ribonuclease type III [ Homo sapiens ]
• Official Symbol: DICER1
• Synonyms: DCR1; MNG1; Dicer; HERNA; RMSE2; Dicer1e; K12H4.8-LIKE; endoribonuclease Dicer; Dicer1, Dcr-1 homolog; dicer 1, double-stranded RNA-specific endoribonuclease; helicase MOI; helicase with RNAse motif
• Gene ID: 23405
• mRNA Refseq: NM_177438
• Protein Refseq: NP_803187
• MIM: 606241
• UniProt ID: Q9UPY3
• Chromosome Location: 14q32.13
• Pathway: Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
• Function: ATP binding; deoxyribonuclease I activity; double-stranded RNA binding