Recombinant Human DIAPH3 protein, His-tagged

Cat.No. : DIAPH3-1483H
Product Overview : Recombinant Human DIAPH3(500 - 850 aa) fused with His tag at N-terminal was expressed in E. coli .
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 500 - 850 aa
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass : ~44 kDa
AA Sequence : DQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFS KLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASK VSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAI DVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVM DNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL
Purity : > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name DIAPH3 diaphanous homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol DIAPH3
Synonyms DIAPH3; diaphanous homolog 3 (Drosophila); auditory neuropathy, autosomal dominant 1 , AUNA1, diaphanous (Drosophila, homolog) 3; protein diaphanous homolog 3; AN; DRF3; FLJ34705; NSDAN; diaphanous-related formin 3; diaphanous-related formin-3; auditory neuropathy, autosomal dominant 1; DIA2; AUNA1; diap3; mDia2; DKFZp434C0931; DKFZp686A13178;
Gene ID 81624
mRNA Refseq NM_001042517
Protein Refseq NP_001035982
MIM 614567
UniProt ID Q9NSV4
Chromosome Location 13q21.2
Pathway CDC42 signaling events, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem;
Function Rho GTPase binding; actin binding; binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DIAPH3 Products

Required fields are marked with *

My Review for All DIAPH3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon