Recombinant Human DIAPH3 protein, His-tagged

• Cat.No.: DIAPH3-1483H
• Product Overview: Recombinant Human DIAPH3(500 - 850 aa) fused with His tag at N-terminal was expressed in E. coli .

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• Molecular Mass: ~44 kDa
• Protein length: 500 - 850 aa
• AA Sequence: DQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFS KLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASK VSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAI DVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVM DNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL
• Purity: > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: DIAPH3 diaphanous homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: DIAPH3
• Synonyms: DIAPH3; diaphanous homolog 3 (Drosophila); auditory neuropathy, autosomal dominant 1 , AUNA1, diaphanous (Drosophila, homolog) 3; protein diaphanous homolog 3; AN; DRF3; FLJ34705; NSDAN; diaphanous-related formin 3; diaphanous-related formin-3; auditory neuropathy, autosomal dominant 1; DIA2; AUNA1; diap3; mDia2; DKFZp434C0931; DKFZp686A13178
• Gene ID: 81624
• mRNA Refseq: NM_001042517
• Protein Refseq: NP_001035982
• MIM: 614567
• UniProt ID: Q9NSV4
• Chromosome Location: 13q21.2
• Pathway: CDC42 signaling events, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem
• Function: Rho GTPase binding; actin binding; binding