Recombinant Human DIAPH1 Protein, GST-tagged

• Cat.No.: DIAPH1-2621H
• Product Overview: Human DIAPH1 partial ORF ( NP_005210, 921 a.a. - 1024 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DIAPH1 diaphanous homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: DIAPH1
• Synonyms: DIAPH1; diaphanous homolog 1 (Drosophila); DFNA1, diaphanous (Drosophila, homolog) 1; protein diaphanous homolog 1; hDIA1; LFHL1; diaphanous-related formin 1; diaphanous-related formin-1; DIA1; DRF1; DFNA1; FLJ25265
• Gene ID: 1729
• mRNA Refseq: NM_001079812
• Protein Refseq: NP_001073280
• MIM: 602121
• UniProt ID: O60610