Recombinant Human DIABLO Protein

• Cat.No.: DIABLO-2617H
• Product Overview: Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 56-239 a.a.
• Description: This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Form: Liquid
• Molecular Mass: 22 kDa
• AA Sequence: MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 1 mg/mL
• Storage Buffer: In 20 mM Tris pH 7.5

Gene Information

• Gene Name: DIABLO diablo, IAP-binding mitochondrial protein [ Homo sapiens ]
• Official Symbol: DIABLO
• Synonyms: DIABLO; diablo, IAP-binding mitochondrial protein; diablo homolog, mitochondrial; DFNA64; DIABLO S; FLJ10537; FLJ25049; second mitochondria derived activator of caspase; SMAC; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase; SMAC3; DIABLO-S
• Gene ID: 56616
• mRNA Refseq: NM_019887
• Protein Refseq: NP_063940
• MIM: 605219
• UniProt ID: Q9NR28