Recombinant Human DHX38 Protein, GST-tagged
Cat.No. : | DHX38-2612H |
Product Overview : | Human DHX38 partial ORF ( NP_054722.2, 342 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHX38 DEAH (Asp-Glu-Ala-His) box polypeptide 38 [ Homo sapiens ] |
Official Symbol | DHX38 |
Synonyms | DHX38; DEAH (Asp-Glu-Ala-His) box polypeptide 38; DDX38, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 38; pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16; hPrp16; KIAA0224; PRP16; PRPF16; DEAH box protein 38; PRP16 homolog of S.cerevisiae; ATP-dependent RNA helicase DHX38; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38; pre-mRNA splicing factor ATP-dependent RNA helicase PRP16; DDX38; |
Gene ID | 9785 |
mRNA Refseq | NM_014003 |
Protein Refseq | NP_054722 |
MIM | 605584 |
UniProt ID | Q92620 |
◆ Recombinant Proteins | ||
DHX38-1263R | Recombinant Rhesus monkey DHX38 Protein, His-tagged | +Inquiry |
DHX38-11124Z | Recombinant Zebrafish DHX38 | +Inquiry |
DHX38-2612H | Recombinant Human DHX38 Protein, GST-tagged | +Inquiry |
DHX38-11987H | Recombinant Human DHX38 protein, GST-tagged | +Inquiry |
DHX38-1088R | Recombinant Rhesus Macaque DHX38 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHX38 Products
Required fields are marked with *
My Review for All DHX38 Products
Required fields are marked with *
0
Inquiry Basket