Recombinant Human DHX15 Protein, His-tagged

• Cat.No.: DHX15-05H
• Product Overview: Recombinant Human DHX15 Protein (147 - 517 aa) was expressed in E. coli with His tag.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.).
• Molecular Mass: 45 kDa
• AA Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage
• Protein length: 147-517 a.a.

Gene Information

• Gene Name: DHX15 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [ Homo sapiens ]
• Official Symbol: DHX15
• Synonyms: DHX15; DEAH (Asp-Glu-Ala-His) box polypeptide 15; DDX15, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 15; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15; DBP1; HRH2; PRP43; PRPF43; PrPp43p; DEAD/H box-15; RNA helicase 2; DEAH box protein 15; ATP-dependent RNA helicase #46; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15; DDX15
• Gene ID: 1665
• mRNA Refseq: NM_001358
• Protein Refseq: NP_001349
• MIM: 603403
• UniProt ID: O43143