Recombinant Human DHRS9 Protein, GST-tagged

• Cat.No.: DHRS9-2603H
• Product Overview: Human DHRS9 full-length ORF ( AAH58883, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
• Molecular Mass: 60.83 kDa
• AA Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHRS9 dehydrogenase/reductase (SDR family) member 9 [ Homo sapiens ]
• Official Symbol: DHRS9
• Synonyms: DHRS9; dehydrogenase/reductase (SDR family) member 9; dehydrogenase/reductase SDR family member 9; 3 alpha hydroxysteroid dehydrogenase; 3alpha HSD; NADP dependent retinol dehydrogenase/reductase; RDH15; RDHL; retinol dehydrogenase homolog; RETSDR8; SDR9C4; short chain dehydrogenase/reductase family 9C; member 4; RDH-E2; 3-alpha-HSD; 3-alpha hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase retSDR8; NADP-dependent retinol dehydrogenase/reductase; short chain dehydrogenase/reductase family 9C, member 4; RDHTBE; 3ALPHA-HSD
• Gene ID: 10170
• mRNA Refseq: NM_001142270
• Protein Refseq: NP_001135742
• MIM: 612131
• UniProt ID: Q9BPW9