Recombinant Human DHRS4L2 Protein, GST-tagged

Cat.No. : DHRS4L2-2600H
Product Overview : Human DHRS4L2 full-length ORF ( NP_932349.1, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the short chain dehydrogenase reductase family. The encoded protein may be an NADPH dependent retinol oxidoreductase. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 51 kDa
AA Sequence : MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHRS4L2 dehydrogenase/reductase (SDR family) member 4 like 2 [ Homo sapiens ]
Official Symbol DHRS4L2
Synonyms DHRS4L2; dehydrogenase/reductase (SDR family) member 4 like 2; dehydrogenase/reductase SDR family member 4-like 2; SDR25C3; short chain dehydrogenase/reductase family 25C; member 3; dehydrogenase/reductase (SDR family) member 4 like 2A3; short chain dehydrogenase/reductase family 25C, member 3; MGC905; FLJ11525;
Gene ID 317749
mRNA Refseq NM_001193635
Protein Refseq NP_001180564
MIM 615196
UniProt ID Q6PKH6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DHRS4L2 Products

Required fields are marked with *

My Review for All DHRS4L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon