Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DHRS1-4509H
• Product Overview: DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 33.9 kDa
• AA Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DHRS1 dehydrogenase/reductase 1 [ Homo sapiens (human) ]
• Official Symbol: DHRS1
• Synonyms: DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523
• Gene ID: 115817
• mRNA Refseq: NM_138452
• Protein Refseq: NP_612461
• MIM: 610410
• UniProt ID: Q96LJ7