Recombinant Human DHFR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DHFR2-4353H
• Product Overview: DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.
• Molecular Mass: 21.6 kDa
• AA Sequence: MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DHFR2 dihydrofolate reductase 2 [ Homo sapiens (human) ]
• Official Symbol: DHFR2
• Synonyms: DHFR2; dihydrofolate reductase 2; DHFRL1; DHFRP4; dihydrofolate reductase 2, mitochondrial; dihydrofolate reductase like 1; dihydrofolate reductase pseudogene 4; dihydrofolate reductase, mitochondrial; dihydrofolate reductase-like protein 1; EC 1.5.1.3
• Gene ID: 200895
• mRNA Refseq: NM_176815
• Protein Refseq: NP_789785
• MIM: 616588
• UniProt ID: Q86XF0