Recombinant Human DHDDS Protein, GST-tagged

• Cat.No.: DHDDS-2583H
• Product Overview: Human DHDDS full-length ORF ( AAH04117.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
• Molecular Mass: 60.7 kDa
• AA Sequence: MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHDDS dehydrodolichyl diphosphate synthase [ Homo sapiens ]
• Official Symbol: DHDDS
• Synonyms: DHDDS; dehydrodolichyl diphosphate synthase; DS; FLJ13102; HDS; dedol-PP synthase; cis-prenyl transferase; cis-isoprenyltransferase; CIT; CPT; RP59
• Gene ID: 79947
• mRNA Refseq: NM_001243564
• Protein Refseq: NP_001230493
• MIM: 608172
• UniProt ID: Q86SQ9