Recombinant Human DGKZ protein, His-tagged
Cat.No. : | DGKZ-3861H |
Product Overview : | Recombinant Human DGKZ protein(297-601 aa), fused to His tag, was expressed in E. coli. |
Availability | April 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 297-601 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPKCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DGKZ diacylglycerol kinase, zeta [ Homo sapiens ] |
Official Symbol | DGKZ |
Synonyms | DGKZ; diacylglycerol kinase, zeta; diacylglycerol kinase, zeta 104kDa; diacylglycerol kinase zeta; DAGK5; DAGK6; DGK ZETA; hDGKzeta; DAG kinase zeta; diglyceride kinase zeta; DGK-ZETA; |
Gene ID | 8525 |
mRNA Refseq | NM_001105540 |
Protein Refseq | NP_001099010 |
MIM | 601441 |
UniProt ID | Q13574 |
◆ Recombinant Proteins | ||
DGKZ-11960H | Recombinant Human DGKZ, His-tagged | +Inquiry |
DGKZ-3861H | Recombinant Human DGKZ protein, His-tagged | +Inquiry |
DGKZ-542HFL | Recombinant Full Length Human DGKZ Protein, C-Flag-tagged | +Inquiry |
DGKZ-26682TH | Recombinant Human DGKZ, His-tagged | +Inquiry |
DGKZ-45H | Recombinant Human DGKZ Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKZ-6953HCL | Recombinant Human DGKZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGKZ Products
Required fields are marked with *
My Review for All DGKZ Products
Required fields are marked with *
0
Inquiry Basket