Recombinant Human DGKZ, His-tagged
Cat.No. : | DGKZ-26682TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 641-895 of Human DGKZ with N terminal His tag; MWt 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Highest levels in brain, and substantial levels in skeletal muscle, heart, and pancreas. Isoform 1 is predominantly expressed in muscle. |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSP KWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILD PELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPP QGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLL HHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTE LAAYLENRQHYQMIQREDQETAV |
Sequence Similarities : | Belongs to the eukaryotic diacylglycerol kinase family.Contains 2 ANK repeats.Contains 1 DAGKc domain.Contains 2 phorbol-ester/DAG-type zinc fingers. |
Protein length : | 641-895 a.a. |
Gene Name | DGKZ diacylglycerol kinase, zeta [ Homo sapiens ] |
Official Symbol | DGKZ |
Synonyms | DGKZ; diacylglycerol kinase, zeta; diacylglycerol kinase, zeta 104kDa; diacylglycerol kinase zeta; DAGK5; DAGK6; DGK ZETA; hDGKzeta; |
Gene ID | 8525 |
mRNA Refseq | NM_001199267 |
Protein Refseq | NP_001186196 |
MIM | 601441 |
Uniprot ID | Q13574 |
Chromosome Location | 11p11.2 |
Pathway | Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; |
Function | ATP binding; diacylglycerol kinase activity; diacylglycerol kinase activity; enzyme inhibitor activity; lipid kinase activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DGKZ Products
Required fields are marked with *
My Review for All DGKZ Products
Required fields are marked with *
0
Inquiry Basket