Recombinant Human DGKK Protein, GST-tagged

• Cat.No.: DGKK-2576H
• Product Overview: Human DGKK partial ORF ( NP_001013764, 1171 a.a. - 1271 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an enzyme that phosphorylates diacylglycerol, converting it to phosphatidic acid. The encoded protein is a membrane protein and is inhibited by hydrogen peroxide. Variations in this gene have been associated with hypospadias. [provided by RefSeq, Mar 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: AEDETALQSALDAMNKEFKKLSEIDWMNPIFVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEGDDPLTPSRSQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DGKK diacylglycerol kinase, kappa [ Homo sapiens ]
• Official Symbol: DGKK
• Synonyms: DGKK; diacylglycerol kinase, kappa; diacylglycerol kinase kappa; DGK-kappa; DAG kinase kappa; diglyceride kinase kappa; 142 kDa diacylglycerol kinase
• Gene ID: 139189
• mRNA Refseq: NM_001013742
• Protein Refseq: NP_001013764
• MIM: 300837
• UniProt ID: Q5KSL6