Recombinant Human DGCR6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DGCR6-1267H
Product Overview : DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia.
Molecular Mass : 24.8 kDa
AA Sequence : MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DGCR6 DiGeorge syndrome critical region gene 6 [ Homo sapiens (human) ]
Official Symbol DGCR6
Synonyms DGCR6; DiGeorge syndrome critical region gene 6; protein DGCR6; DiGeorge syndrome critical region protein 6;
Gene ID 8214
mRNA Refseq NM_005675
Protein Refseq NP_005666
MIM 601279
UniProt ID Q14129

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DGCR6 Products

Required fields are marked with *

My Review for All DGCR6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon