Recombinant Human DGCR6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DGCR6-1267H
• Product Overview: DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia.
• Molecular Mass: 24.8 kDa
• AA Sequence: MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DGCR6 DiGeorge syndrome critical region gene 6 [ Homo sapiens (human) ]
• Official Symbol: DGCR6
• Synonyms: DGCR6; DiGeorge syndrome critical region gene 6; protein DGCR6; DiGeorge syndrome critical region protein 6
• Gene ID: 8214
• mRNA Refseq: NM_005675
• Protein Refseq: NP_005666
• MIM: 601279
• UniProt ID: Q14129