Recombinant Human DGCR6 Protein, GST-tagged

Description :	DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	51.4 kDa
AA Sequence :	MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	DGCR6 DiGeorge syndrome critical region gene 6 [ Homo sapiens ]
Official Symbol	DGCR6
Synonyms	DGCR6; DiGeorge syndrome critical region gene 6; protein DGCR6; DiGeorge syndrome critical region protein 6;
Gene ID	8214
mRNA Refseq	NM_005675
Protein Refseq	NP_005666
MIM	601279
UniProt ID	Q14129