Recombinant Human DESI1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DESI1-6133H
Product Overview : PPPDE2 MS Standard C13 and N15-labeled recombinant protein (NP_056519) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. Diseases associated with DESI1 include Parkinson Disease 7, Autosomal Recessive Early-Onset. Gene Ontology (GO) annotations related to this gene include identical protein binding and peptidase activity. An important paralog of this gene is DESI2.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 18.3 kDa
AA Sequence : MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ]
Official Symbol DESI1
Synonyms DESI1; desumoylating isopeptidase 1; POST; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B; polyubiquitinated substrate transporter
Gene ID 27351
mRNA Refseq NM_015704
Protein Refseq NP_056519
MIM 614637
UniProt ID Q6ICB0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DESI1 Products

Required fields are marked with *

My Review for All DESI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon