Recombinant Human DEPDC1, GST-tagged

• Cat.No.: DEPDC1-120H
• Product Overview: Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Cat. No.: DEPDC1-120H
• Description: DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene.
• Source: wheat germ
• Molecular Mass: 36.08 kDa
• Sequence: GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: DEPDC1

Gene Information

• Gene Name: DEPDC1 DEP domain containing 1 [ Homo sapiens ]
• Synonyms: DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35
• Gene ID: 55635
• mRNA Refseq: NM_017779
• Protein Refseq: NP_060249
• MIM: 612002
• UniProt ID: Q5TB30
• Chromosome Location: 1p31.2
• Function: GTPase activator activity; protein binding