Recombinant Human DENND5A protein, GST-tagged

• Cat.No.: DENND5A-3769H
• Product Overview: Recombinant Human DENND5A protein(1-60 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-60 aa
• AA Sequence: MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DENND5A DENN/MADD domain containing 5A [ Homo sapiens ]
• Official Symbol: DENND5A
• Synonyms: DENND5A; DENN/MADD domain containing 5A; RAB6 interacting protein 1 , RAB6IP1; DENN domain-containing protein 5A; FLJ22354; FLJ33829; FLJ43455; KIAA1091; RAB6 interacting protein 1; rab6-interacting protein 1; RAB6IP1
• Gene ID: 23258
• mRNA Refseq: NM_001243254
• Protein Refseq: NP_001230183
• UniProt ID: Q6IQ26