Recombinant Human DEFB125 Protein, GST-tagged

• Cat.No.: DEFB125-2526H
• Product Overview: Human DEFB125 full-length ORF (BAG34745.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.12 kDa
• AA Sequence: MLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAFPVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB125 defensin, beta 125 [ Homo sapiens ]
• Official Symbol: DEFB125
• Synonyms: DEFB-25
• Gene ID: 245938
• mRNA Refseq: NM_153325.2
• Protein Refseq: NP_697020.2
• UniProt ID: Q8N687