Recombinant Human DEFB124 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEFB124-4857H
• Product Overview: DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.9 kDa
• AA Sequence: MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEFB124 defensin beta 124 [ Homo sapiens (human) ]
• Official Symbol: DEFB124
• Synonyms: DEFB124; defensin beta 124; DEFB-24; beta-defensin 124; beta-defensin 24; defensin, beta 24
• Gene ID: 245937
• mRNA Refseq: NM_001037500
• Protein Refseq: NP_001032589
• UniProt ID: Q8NES8