Recombinant Human DEFB110 Protein, GST-tagged

• Cat.No.: DEFB110-2524H
• Product Overview: Human DEFB110 full-length ORF (AAI48764.1, 1 a.a. - 62 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
• Molecular Mass: 33.77 kDa
• AA Sequence: MKIQLFFFILHFWVTILPARSNFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB110 defensin, beta 110 locus [ Homo sapiens ]
• Official Symbol: DEFB110
• Synonyms: DEFB110; defensin, beta 110 locus; defensin, beta 110; beta-defensin 110; DEFB 10; DEFB 11; DEFB111; beta-defensin 10; beta-defensin 11; beta-defensin 111; defensin, beta 10; DEFB-10; DEFB-11; MGC183056; MGC190230
• Gene ID: 245913
• mRNA Refseq: NM_001037497
• Protein Refseq: NP_001032586
• UniProt ID: Q30KQ9