Recombinant Human DEFB106A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEFB106A-3898H
• Product Overview: DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy.
• Molecular Mass: 7.4 kDa
• AA Sequence: MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEFB106A defensin beta 106A [ Homo sapiens (human) ]
• Official Symbol: DEFB106A
• Synonyms: DEFB106A; defensin, beta 106A; DEFB106, defensin, beta 106; beta-defensin 106; DEFB 6; beta-defensin 6; defensin, beta 6; BD-6; DEFB-6; DEFB106; MGC118938; MGC118939; MGC118940; MGC118941; MGC133011; MGC133012
• Gene ID: 245909
• mRNA Refseq: NM_152251
• Protein Refseq: NP_689464
• UniProt ID: Q8N104