Recombinant Human DEFB106A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DEFB106A-3898H |
Product Overview : | DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy. |
Molecular Mass : | 7.4 kDa |
AA Sequence : | MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DEFB106A defensin beta 106A [ Homo sapiens (human) ] |
Official Symbol | DEFB106A |
Synonyms | DEFB106A; defensin, beta 106A; DEFB106, defensin, beta 106; beta-defensin 106; DEFB 6; beta-defensin 6; defensin, beta 6; BD-6; DEFB-6; DEFB106; MGC118938; MGC118939; MGC118940; MGC118941; MGC133011; MGC133012; |
Gene ID | 245909 |
mRNA Refseq | NM_152251 |
Protein Refseq | NP_689464 |
UniProt ID | Q8N104 |
◆ Recombinant Proteins | ||
DEFB106A-3898H | Recombinant Human DEFB106A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEFB106A-446H | Recombinant Human DEFB106A Protein, MYC/DDK-tagged | +Inquiry |
DEFB106A-1077C | Recombinant Chimpanzee DEFB106A protein, His-KSI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB106A-6987HCL | Recombinant Human DEFB106A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB106A Products
Required fields are marked with *
My Review for All DEFB106A Products
Required fields are marked with *
0
Inquiry Basket