Name: Recombinant Human DEFB105A protein
SKU: DEFB105A-7377H

Specification
Gene Information
Related Products
Download

Species :	Human
Source :	E.coli
Tag :	Non
Protein Length :	51
Description :	Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 105, DEFB105A and DEFB105B, in tail-to-tail orientation. This gene, DEFB105A, represents the more centromeric copy.
Form :	Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass :	Approximately 5.8 kDa, a single non-glycosylated polypeptide chain containing 51 amino acids.
AA Sequence :	GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
Endotoxin :	Less than 1.0 EU/µg of rHuBD-5 as determined by LAL method.
Purity :	>95% by SDS-PAGE and HPLC analyses.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.