Recombinant Human DEFA3 Protein, GST-tagged

• Cat.No.: DEFA3-2518H
• Product Overview: Human DEFA3 full-length ORF ( NP_005208.1, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.6 kDa
• AA Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ]
• Official Symbol: DEFA3
• Synonyms: DEFA3; defensin, alpha 3, neutrophil-specific; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; defensin 3, neutrophil-specific; HP3; HNP3; HP-3; HNP-3
• Gene ID: 1668
• mRNA Refseq: NM_005217
• Protein Refseq: NP_005208
• MIM: 604522
• UniProt ID: P59666