Recombinant Human DEDD2 Protein, GST-tagged

• Cat.No.: DEDD2-2515H
• Product Overview: Human DEDD2 full-length ORF ( AAH13372.2, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a nuclear-localized protein containing a death effector domain (DED). The encoded protein may regulate the trafficking of caspases and other proteins into the nucleus during death receptor-induced apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
• Molecular Mass: 47 kDa
• AA Sequence: MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLARARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTSSSSKRTEGSCRRRRQSSSSANSQQGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQQQSEPAQTFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEDD2 death effector domain containing 2 [ Homo sapiens ]
• Official Symbol: DEDD2
• Synonyms: DEDD2; death effector domain containing 2; DNA-binding death effector domain-containing protein 2; FLAME 3; DED-containing protein FLAME-3; FADD-like anti-apoptotic molecule 3; death effector domain-containing DNA binding protein 2; FLAME-3
• Gene ID: 162989
• mRNA Refseq: NM_133328
• Protein Refseq: NP_579874
• MIM: 617078
• UniProt ID: Q8WXF8