Recombinant Human DECR1, GST-tagged
Cat.No. : | DECR1-973H |
Product Overview : | Recombinant human DECR1 with gst tag atN-terminal was produced in wheat germ expressionsystem in vitro and purified by Glutathione Sepharose 4 Fast Flow, 36.74 kDa(236 a.a. - 335 a.a.). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 236-335 a.a. |
Description : | This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters. |
Amino Acid Sequence : | NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS |
Note : | Best use within three months from the date ofreceipt of this protein. |
Applications : | ELISA;WB; Antibody Production; Protein Array |
StorageBuffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Storage : | Store at-80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | DECR1 |
Gene Name | DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens] |
Synonyms | DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH] |
Gene ID | 1666 |
mRNA Refseq | NM_001359 |
Protein Refseq | NP_001350 |
MIM | 222745 |
UniProt ID | Q16698 |
Chromosome Location | 8q21.3 |
Pathway | Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid |
Function | 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding |
◆ Recombinant Proteins | ||
DECR1-205C | Recombinant Cynomolgus Monkey DECR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Decr1-2516M | Recombinant Mouse Decr1 Protein, Myc/DDK-tagged | +Inquiry |
DECR1-459C | Recombinant Cynomolgus DECR1 Protein, His-tagged | +Inquiry |
DECR1-576Z | Recombinant Zebrafish DECR1 | +Inquiry |
DECR1-973H | Recombinant Human DECR1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DECR1-6997HCL | Recombinant Human DECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DECR1 Products
Required fields are marked with *
My Review for All DECR1 Products
Required fields are marked with *
0
Inquiry Basket