Recombinant Human DECR1, GST-tagged

• Cat.No.: DECR1-973H
• Product Overview: Recombinant human DECR1 with gst tag atN-terminal was produced in wheat germ expressionsystem in vitro and purified by Glutathione Sepharose 4 Fast Flow, 36.74 kDa(236 a.a. - 335 a.a.).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 236-335 a.a.
• Description: This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
• Amino Acid Sequence: NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
• Note: Best use within three months from the date ofreceipt of this protein.
• Applications: ELISA;WB; Antibody Production; Protein Array
• StorageBuffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Storage: Store at-80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: DECR1

Gene Information

• Gene Name: DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
• Synonyms: DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
• Gene ID: 1666
• mRNA Refseq: NM_001359
• Protein Refseq: NP_001350
• MIM: 222745
• UniProt ID: Q16698
• Chromosome Location: 8q21.3
• Pathway: Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
• Function: 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding