Recombinant Human DDX58, GST-tagged

• Cat.No.: DDX58-10H
• Product Overview: Recombinant Human DDX58 (1 a.a. - 925 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Cat. No.: DDX58-10H
• Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of immune response.
• Source: wheat germ
• Molecular Mass: 133 kDa
• Sequence: MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSG LYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTL KLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAM KGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVEN NDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYI CKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQW IVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQEL ESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCIL DAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRL QTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPK QFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: Best use within three months from the date of receipt of this protein.
• OfficialSymbol: DDX58

Gene Information

• Gene Name: DDX58 DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [ Homo sapiens ]
• Synonyms: DDX58; RIGI; RIG-I; RLR-1; RIG-1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; probable ATP-dependent RNA helicase DDX58; RNA helicase RIG-I; DEAD box protein 58; RIG-I-like receptor 1; retinoic acid inducible gene I; retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; EC 3.6.4.13; DKFZp434J1111; FLJ13599
• Gene ID: 23586
• mRNA Refseq: NM_014314
• Protein Refseq: NP_055129
• MIM: 609631
• UniProt ID: O95786
• Chromosome Location: 9p12
• Pathway: Antiviral mechanism by IFN-stimulated genes; Cytokine Signaling in Immune system; Cytosolic DNA-sensing pathway; Epstein-Barr virus infection; Herpes simplex infection
• Function: ATP binding; ATP-dependent helicase activity; double-stranded DNA binding; double-stranded RNA binding; identical protein binding; protein binding; single-stranded RNA binding; zinc ion binding