Recombinant Human DDX39B, His-tagged
Cat.No. : | DDX39B-31447TH |
Product Overview : | Recombinant full length Human UAP56 with an N terminal His tag; 448 amino acids with a predicted MWt 51.1kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. This gene belongs to a cluster of genes localized in the vicinity of the genes encoding tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs between this gene and the upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. |
Protein length : | 428 amino acids |
Conjugation : | HIS |
Molecular Weight : | 51.100kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR |
Sequence Similarities : | Belongs to the DEAD box helicase family. DECD subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
Gene Name | DDX39B DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B [ Homo sapiens ] |
Official Symbol | DDX39B |
Synonyms | DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; BAT1, HLA B associated transcript 1; spliceosome RNA helicase DDX39B; D6S81E; U2AF65 associated protein 56; UAP56; |
Gene ID | 7919 |
mRNA Refseq | NM_004640 |
Protein Refseq | NP_004631 |
MIM | 142560 |
Uniprot ID | Q13838 |
Chromosome Location | 6p21.33 |
Pathway | Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; |
Function | ATP binding; ATP-dependent RNA helicase activity; ATP-dependent helicase activity; ATP-dependent protein binding; RNA binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DDX39B Products
Required fields are marked with *
My Review for All DDX39B Products
Required fields are marked with *
0
Inquiry Basket