Recombinant Human DDX19A Protein, GST-tagged

• Cat.No.: DDX19A-2469H
• Product Overview: Human DDX19A full-length ORF ( NP_060802.1, 1 a.a. - 478 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DDX19A (DEAD-Box Helicase 19A) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is ENSG00000260537.
• Molecular Mass: 80.4 kDa
• AA Sequence: MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDX19A DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A [ Homo sapiens ]
• Official Symbol: DDX19A
• Synonyms: DDX19A; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A; DDX19L, DEAD (Asp Glu Ala As) box polypeptide 19 like; ATP-dependent RNA helicase DDX19A; FLJ11126; RNA helicase; DDX19-like protein; DEAD box protein 19A; DEAD (Asp-Glu-Ala-As) box polypeptide 19A; DDX19L; DDX19-DDX19L; DKFZp686C21137
• Gene ID: 55308
• mRNA Refseq: NM_018332
• Protein Refseq: NP_060802
• UniProt ID: Q9NUU7