Recombinant Full Length Human DDX19A Protein, C-Flag-tagged
Cat.No. : | DDX19A-1612HFL |
Product Overview : | Recombinant Full Length Human DDX19A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable RNA binding activity and RNA helicase activity. Predicted to be involved in poly(A)+ mRNA export from nucleus. Located in membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLV DNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSG TGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISE QIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSV WKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAA ELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNE TYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIANTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DDX19A DEAD-box helicase 19A [ Homo sapiens (human) ] |
Official Symbol | DDX19A |
Synonyms | DDX19L; DDX19-DDX19L |
Gene ID | 55308 |
mRNA Refseq | NM_018332.5 |
Protein Refseq | NP_060802.1 |
UniProt ID | Q9NUU7 |
◆ Recombinant Proteins | ||
DDX19A-2538HF | Recombinant Full Length Human DDX19A Protein, GST-tagged | +Inquiry |
DDX19A-2469H | Recombinant Human DDX19A Protein, GST-tagged | +Inquiry |
DDX19A-4929H | Recombinant Human DDX19A protein, His-SUMO-tagged | +Inquiry |
DDX19A-2265M | Recombinant Mouse DDX19A Protein, His (Fc)-Avi-tagged | +Inquiry |
Ddx19a-2500M | Recombinant Mouse Ddx19a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX19A-7018HCL | Recombinant Human DDX19A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX19A Products
Required fields are marked with *
My Review for All DDX19A Products
Required fields are marked with *
0
Inquiry Basket