Recombinant Human DDX17

• Cat.No.: DDX17-28323TH
• Product Overview: Recombinant fragment corresponding to amino acids 470-652 of Human DDX17 with a proprietary tag; Predicted MWt 46.2 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 183 amino acids
• Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. This gene can encode multiple isoforms due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) start codon.
• Molecular Weight: 46.200kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK
• Sequence Similarities: Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.

Gene Information

• Gene Name: DDX17 DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [ Homo sapiens ]
• Official Symbol: DDX17
• Synonyms: DDX17; DEAD (Asp-Glu-Ala-Asp) box polypeptide 17; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 17 (72kD); probable ATP-dependent RNA helicase DDX17; P72
• Gene ID: 10521
• mRNA Refseq: NM_001098504
• Protein Refseq: NP_001091974
• MIM: 608469
• Uniprot ID: Q92841
• Chromosome Location: 22q13.1
• Function: ATP binding; ATP-dependent helicase activity; RNA binding; RNA helicase activity; RNA-dependent ATPase activity