Recombinant Human DDT, His-tagged

• Cat.No.: DDT-26544TH
• Product Overview: Recombinant full length Human DDT with an N terminal His tag; 138aa, 14.8kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 118 amino acids
• Description: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
• Conjugation: HIS
• Molecular Weight: 14.800kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• Sequence Similarities: Belongs to the MIF family.

Gene Information

• Gene Name: DDT D-dopachrome tautomerase [ Homo sapiens ]
• Official Symbol: DDT
• Synonyms: DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT
• Gene ID: 1652
• mRNA Refseq: NM_001084392
• Protein Refseq: NP_001077861
• MIM: 602750
• Uniprot ID: P30046
• Chromosome Location: 22q11.23
• Pathway: Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem
• Function: D-dopachrome decarboxylase activity; dopachrome isomerase activity; lyase activity