Recombinant Human DDR2 protein, His-tagged
Cat.No. : | DDR2-3009H |
Product Overview : | Recombinant Human DDR2 protein(291-398 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 291-398 aa |
AA Sequence : | MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDR2 discoidin domain receptor tyrosine kinase 2 [ Homo sapiens ] |
Official Symbol | DDR2 |
Synonyms | DDR2; discoidin domain receptor tyrosine kinase 2; discoidin domain receptor family, member 2 , NTRKR3, TYRO10; discoidin domain-containing receptor 2; TKT; tyrosylprotein kinase; hydroxyaryl-protein kinase; discoidin domain receptor 2; tyrosine-protein kinase TYRO10; CD167 antigen-like family member B; cell migration-inducing protein 20; migration-inducing gene 16 protein; receptor protein-tyrosine kinase TKT; discoidin domain receptor family, member 2; neurotrophic tyrosine kinase receptor related 3; neurotrophic tyrosine kinase, receptor-related 3; discoidin domain-containing receptor tyrosine kinase 2; MIG20a; NTRKR3; TYRO10; |
Gene ID | 4921 |
mRNA Refseq | NM_001014796 |
Protein Refseq | NP_001014796 |
MIM | 191311 |
UniProt ID | Q16832 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DDR2 Products
Required fields are marked with *
My Review for All DDR2 Products
Required fields are marked with *
0
Inquiry Basket