Recombinant Human DDAH2, His-tagged

Cat.No. : DDAH2-26260TH
Product Overview : Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-261 a.a.
Description : This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Conjugation : HIS
Tissue specificity : Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
Form : Lyophilised:Reconstitute with 53 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS
Sequence Similarities : Belongs to the DDAH family.
Gene Name DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ]
Official Symbol DDAH2
Synonyms DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2;
Gene ID 23564
mRNA Refseq NM_013974
Protein Refseq NP_039268
MIM 604744
Uniprot ID O95865
Chromosome Location 6p21
Function amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDAH2 Products

Required fields are marked with *

My Review for All DDAH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon