Recombinant Human DCUN1D1 Protein, GST-tagged

• Cat.No.: DCUN1D1-2418H
• Product Overview: Human DCUN1D1 full-length ORF ( NP_065691.2, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma Of The Oral Tongue and Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.5 kDa
• AA Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCUN1D1
• Synonyms: DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1
• Gene ID: 54165
• mRNA Refseq: NM_020640
• Protein Refseq: NP_065691
• MIM: 605905
• UniProt ID: Q96GG9