Recombinant Human DCUN1D1, His-tagged

• Cat.No.: DCUN1D1-26174TH
• Product Overview: Recombinant full length Human DCUN1D1 with an N terminal His tag; 279 amino acids with a predicted MWt 32.2 kDa including tag.

Specification

• Description: DCUN1D1, also known as DCN1-like protein 1, is involved in the malignant transformation of squamous cell lineage.
• Protein length: 259 amino acids
• Conjugation: HIS
• Molecular Weight: 32.200kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

Gene Information

• Gene Name: DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCUN1D1
• Synonyms: DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
• Gene ID: 54165
• mRNA Refseq: NM_020640
• Protein Refseq: NP_065691
• MIM: 605905
• Uniprot ID: Q96GG9
• Chromosome Location: 3q26.3
• Function: protein binding