Recombinant Human DCTN5 protein, T7-tagged

• Cat.No.: DCTN5-140H
• Product Overview: Recombinant human DCTN5 (182 aa, Isoform-I) protein fused with 15aa (T7) at N-terminal, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 182 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLP PETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro DCTN5 mediated dynein motor regulation study for intracellular cargo transportation by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping DCTN5 protein – protein interaction assay.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. May be used for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: DCTN5 dynactin 5 (p25) [ Homo sapiens ]
• Official Symbol: DCTN5
• Synonyms: DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25
• Gene ID: 84516
• mRNA Refseq: NM_001199011
• Protein Refseq: NP_001185940
• MIM: 612962
• UniProt ID: Q9BTE1
• Chromosome Location: 16p12.1
• Pathway: Vasopressin-regulated water reabsorption, organism-specific biosystem; Vasopressin-regulated water reabsorption, conserved biosystem
• Function: transferase activity