Recombinant Human DCTN5 Protein, GST-tagged

• Cat.No.: DCTN5-2415H
• Product Overview: Human DCTN5 full-length ORF ( ADZ15660.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
• Molecular Mass: 20.1 kDa
• AA Sequence: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCTN5 dynactin 5 (p25) [ Homo sapiens ]
• Official Symbol: DCTN5
• Synonyms: DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25
• Gene ID: 84516
• mRNA Refseq: NM_001199011
• Protein Refseq: NP_001185940
• MIM: 612962
• UniProt ID: Q9BTE1