Recombinant Human DCTN2, His-tagged
Cat.No. : | DCTN2-26061TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 132-406 of Human Dynamitin with N terminas His tag, 275aa, 35kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 132-406 a.a. |
Description : | This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 52 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINL TDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSL VTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQ DAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR LQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWS PIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQ MIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM KKLGK |
Gene Name | DCTN2 dynactin 2 (p50) [ Homo sapiens ] |
Official Symbol | DCTN2 |
Synonyms | DCTN2; dynactin 2 (p50); dynactin subunit 2; DCTN 50; RBP50; |
Gene ID | 10540 |
mRNA Refseq | NM_006400 |
Protein Refseq | NP_006391 |
MIM | 607376 |
Uniprot ID | Q13561 |
Chromosome Location | 12q13.3 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | motor activity; protein binding; |
◆ Recombinant Proteins | ||
DCTN2-6365C | Recombinant Chicken DCTN2 | +Inquiry |
DCTN2-2490H | Recombinant human DCTN2, His-tagged | +Inquiry |
DCTN2-26061TH | Recombinant Human DCTN2, His-tagged | +Inquiry |
DCTN2-1801R | Recombinant Rat DCTN2 Protein | +Inquiry |
DCTN2-1693H | Recombinant Human DCTN2 Protein (Met1-Lys401), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTN2-7042HCL | Recombinant Human DCTN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCTN2 Products
Required fields are marked with *
My Review for All DCTN2 Products
Required fields are marked with *
0
Inquiry Basket