Recombinant Human DCTN2, His-tagged

Cat.No. : DCTN2-26061TH
Product Overview : Recombinant fragment, corresponding to amino acids 132-406 of Human Dynamitin with N terminas His tag, 275aa, 35kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 132-406 a.a.
Description : This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Conjugation : HIS
Form : Lyophilised:reconstitution with 52 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINL TDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSL VTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQ DAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR LQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWS PIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQ MIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM KKLGK
Gene Name DCTN2 dynactin 2 (p50) [ Homo sapiens ]
Official Symbol DCTN2
Synonyms DCTN2; dynactin 2 (p50); dynactin subunit 2; DCTN 50; RBP50;
Gene ID 10540
mRNA Refseq NM_006400
Protein Refseq NP_006391
MIM 607376
Uniprot ID Q13561
Chromosome Location 12q13.3
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function motor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCTN2 Products

Required fields are marked with *

My Review for All DCTN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon