Recombinant Human DCPS protein(7-160 aa), GST-tagged
Cat.No. : | DCPS-11863H |
Product Overview : | Recombinant Human DCPS protein(7-160 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 7-160 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | DCPS decapping enzyme, scavenger [ Homo sapiens ] |
Official Symbol | DCPS |
Synonyms | DCPS; HSL1; HINT-5; HSPC015; decapping enzyme, scavenger ; scavenger mRNA-decapping enzyme DcpS; DCS-1; OTTHUMP00000231113; mRNA decapping enzyme; heat shock-like protein 1;histidine triad protein member 5; hint-related 7meGMP-directed hydrolase; homolog of C. elegans 7meGMP-directed hydrolase dcs-1; EC 3 |
Gene ID | 28960 |
mRNA Refseq | NM_014026 |
Protein Refseq | NP_054745 |
MIM | 610534 |
UniProt ID | Q96C86 |
◆ Recombinant Proteins | ||
DCPS-27368TH | Recombinant Human DCPS, His-tagged | +Inquiry |
DCPS-11862H | Recombinant Human DCPS protein(1-337 aa), His-tagged | +Inquiry |
DCPS-11864H | Recombinant Human DCPS protein(7-160 aa), His-tagged | +Inquiry |
DCPS-4360M | Recombinant Mouse DCPS Protein, His-tagged | +Inquiry |
DCPS-2403H | Recombinant Human DCPS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCPS-7046HCL | Recombinant Human DCPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCPS Products
Required fields are marked with *
My Review for All DCPS Products
Required fields are marked with *
0
Inquiry Basket