Recombinant Human DCP1A Protein, GST-tagged
Cat.No. : | DCP1A-2399H |
Product Overview : | Human DCP1A full-length ORF ( AAH07439.1, 1 a.a. - 582 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
Molecular Mass : | 89.7 kDa |
AA Sequence : | MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCP1A DCP1 decapping enzyme homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCP1A |
Synonyms | DCP1A; DCP1 decapping enzyme homolog A (S. cerevisiae); mRNA-decapping enzyme 1A; HSA275986; SMAD4IP1; SMIF; decapping enzyme hDcp1a; transcription factor SMIF; putative protein product of Nbla00360; Smad4-interacting transcriptional co-activator; Nbla00360; FLJ21691; |
Gene ID | 55802 |
mRNA Refseq | NM_018403 |
Protein Refseq | NP_060873 |
MIM | 607010 |
UniProt ID | Q9NPI6 |
◆ Recombinant Proteins | ||
DCP1A-2399H | Recombinant Human DCP1A Protein, GST-tagged | +Inquiry |
DCP1A-2236M | Recombinant Mouse DCP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
DCP1A-4356M | Recombinant Mouse DCP1A Protein | +Inquiry |
Dcp1a-2476M | Recombinant Mouse Dcp1a Protein, Myc/DDK-tagged | +Inquiry |
DCP1A-6648H | Recombinant Human DCP1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP1A-7048HCL | Recombinant Human DCP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCP1A Products
Required fields are marked with *
My Review for All DCP1A Products
Required fields are marked with *
0
Inquiry Basket