Recombinant Human DCK Protein, His-tagged
Cat.No. : | DCK-27365TH |
Product Overview : | Recombinant Human DCK protein (1-260aa), fused with His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-260 a.a. |
Description : | DCK is a key enzyme in the salvage of deoxyribonucleosides and in the activation of clinically relevant nucleoside analogues. This protein is responsible for the 5-phosphorylation of purine and pyrimidine deoxynucleosides to the corresponding monophosphates using ATP or uTP as phosphate donors. Deficiency of this enzyme activity is associated with resistance to antiviral and anticancer chemotherapeutic agents, whereas increased enzyme activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. Recombinant human DCK protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography. |
Form : | Liquid |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
Purity : | > 90% by SDS-PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | In 20 mM Tris-HCl Buffer (pH 7.5) containing 1 mM DTT, 0.1 mM PMSF, 2mM EDTA, 10% Glycerol |
Gene Name | DCK deoxycytidine kinase [ Homo sapiens (human) ] |
Official Symbol | DCK |
Synonyms | DCK; deoxycytidine kinase; deoxycytidine kinase; deoxynucleoside kinase; EC 2.7.1.74 |
Gene ID | 1633 |
mRNA Refseq | NM_000788 |
Protein Refseq | NP_000779 |
MIM | 125450 |
UniProt ID | P27707 |
◆ Recombinant Proteins | ||
DCK-796H | Recombinant Human DCK, His-tagged | +Inquiry |
DCK-1183H | Recombinant Human DCK protein(1-260aa), His&Myc-tagged | +Inquiry |
DCK-2265B | Recombinant Bacillus subtilis DCK protein, His-tagged | +Inquiry |
DCK-2231M | Recombinant Mouse DCK Protein, His (Fc)-Avi-tagged | +Inquiry |
DCK-795H | Recombinant Human Deoxycytidine Kinase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCK-7051HCL | Recombinant Human DCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCK Products
Required fields are marked with *
My Review for All DCK Products
Required fields are marked with *
0
Inquiry Basket