Recombinant Human DBNDD2 protein, GST-tagged

• Cat.No.: DBNDD2-301501H
• Product Overview: Recombinant Human DBNDD2 (60-161 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Asp60-Ser161
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DBNDD2 dysbindin (dystrobrevin binding protein 1) domain containing 2 [ Homo sapiens ]
• Official Symbol: DBNDD2
• Synonyms: CK1BP; HSMNP1; C20orf35
• Gene ID: 55861
• mRNA Refseq: NM_018478.3
• Protein Refseq: NP_060948.3
• MIM: 611453
• UniProt ID: Q9BQY9