Recombinant Human DAZ1 Protein, GST-tagged
Cat.No. : | DAZ1-2354H |
Product Overview : | Human DAZ1 partial ORF ( AAH18119, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAZ1 deleted in azoospermia 1 [ Homo sapiens ] |
Official Symbol | DAZ1 |
Synonyms | DAZ1; deleted in azoospermia 1; DAZ, deleted in azoospermia; deleted in azoospermia protein 1; SPGY; DAZ; FLJ17175; |
Gene ID | 1617 |
mRNA Refseq | NM_004081 |
Protein Refseq | NP_004072 |
MIM | 400003 |
UniProt ID | Q9NQZ3 |
◆ Recombinant Proteins | ||
DAZ1-2354H | Recombinant Human DAZ1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAZ1 Products
Required fields are marked with *
My Review for All DAZ1 Products
Required fields are marked with *
0
Inquiry Basket