Recombinant Human DAPP1 Protein, GST-tagged

• Cat.No.: DAPP1-2344H
• Product Overview: Human DAPP1 full-length ORF ( AAH12924, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I PI3K signaling events. GO annotations related to this gene include phospholipid binding and phosphatidylinositol-3,4-bisphosphate binding.
• Molecular Mass: 56.32 kDa
• AA Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DAPP1 dual adaptor of phosphotyrosine and 3-phosphoinositides [ Homo sapiens ]
• Official Symbol: DAPP1
• Synonyms: DAPP1; dual adaptor of phosphotyrosine and 3-phosphoinositides; dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; BAM32; hDAPP1; B-cell adapter molecule of 32 kDa; b lymphocyte adapter protein Bam32; DKFZp667E0716
• Gene ID: 27071
• mRNA Refseq: NM_014395
• Protein Refseq: NP_055210
• MIM: 605768
• UniProt ID: Q9UN19