Recombinant Full Length Human DAPP1 Protein, GST-tagged

Cat.No. : DAPP1-2512HF
Product Overview : Human DAPP1 full-length ORF ( AAH12924, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 280 amino acids
Description : DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I PI3K signaling events. GO annotations related to this gene include phospholipid binding and phosphatidylinositol-3,4-bisphosphate binding.
Molecular Mass : 56.32 kDa
AA Sequence : MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAPP1 dual adaptor of phosphotyrosine and 3-phosphoinositides [ Homo sapiens ]
Official Symbol DAPP1
Synonyms DAPP1; dual adaptor of phosphotyrosine and 3-phosphoinositides; dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; BAM32; hDAPP1; B-cell adapter molecule of 32 kDa; b lymphocyte adapter protein Bam32; DKFZp667E0716;
Gene ID 27071
mRNA Refseq NM_014395
Protein Refseq NP_055210
MIM 605768
UniProt ID Q9UN19

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DAPP1 Products

Required fields are marked with *

My Review for All DAPP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon