Recombinant Human DAD1 Protein, GST-tagged
Cat.No. : | DAD1-2324H |
Product Overview : | Human DAD1 full-length ORF ( AAH07403, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 38.17 kDa |
AA Sequence : | MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAD1 defender against cell death 1 [ Homo sapiens ] |
Official Symbol | DAD1 |
Synonyms | DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1; |
Gene ID | 1603 |
mRNA Refseq | NM_001344 |
Protein Refseq | NP_001335 |
MIM | 600243 |
UniProt ID | P61803 |
◆ Cell & Tissue Lysates | ||
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAD1 Products
Required fields are marked with *
My Review for All DAD1 Products
Required fields are marked with *
0
Inquiry Basket