Recombinant Human DAD1

• Cat.No.: DAD1-27092TH
• Product Overview: Recombinant full length Human DAD1 with N terminal proprietary tag, 38.17 kDa.

Specification

• Description: DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line.The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis.DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
• Protein length: 113 amino acids
• Molecular Weight: 38.170kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQ NKADFQGISPERAFADFLFASTILHLVVMNFVG
• Sequence Similarities: Belongs to the DAD/OST2 family.
• Tag: Non

Gene Information

• Gene Name: DAD1 defender against cell death 1 [ Homo sapiens ]
• Official Symbol: DAD1
• Synonyms: DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2
• Gene ID: 1603
• mRNA Refseq: NM_001344
• Protein Refseq: NP_001335
• MIM: 600243
• Uniprot ID: P61803
• Chromosome Location: 14q11.2
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem
• Function: contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; contributes_to oligosaccharyl transferase activity; transferase activity