Recombinant Human DAAM2 Protein, GST-tagged

• Cat.No.: DAAM2-2313H
• Product Overview: Human DAAM2 full-length ORF ( AAH47575.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DAAM2 (Dishevelled Associated Activator Of Morphogenesis 2) is a Protein Coding gene. Diseases associated with DAAM2 include Intestinal Volvulus. Among its related pathways are Wnt Signaling Pathway and Pluripotency and WNT Signaling. GO annotations related to this gene include binding and Rho GTPase binding. An important paralog of this gene is DAAM1.
• Molecular Mass: 41.3 kDa
• AA Sequence: MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DAAM2 dishevelled associated activator of morphogenesis 2 [ Homo sapiens ]
• Official Symbol: DAAM2
• Synonyms: DAAM2; dishevelled associated activator of morphogenesis 2; disheveled-associated activator of morphogenesis 2; KIAA0381; dishevelled-associated activator of morphogenesis 2; dJ90A20A.1; RP1-278E11.1; MGC90515
• Gene ID: 23500
• mRNA Refseq: NM_001201427
• Protein Refseq: NP_001188356
• MIM: 606627
• UniProt ID: Q86T65